diff --git a/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/manifest.yml b/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/manifest.yml
new file mode 100644
index 0000000..7a2d9cd
--- /dev/null
+++ b/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/manifest.yml
@@ -0,0 +1,5 @@
+---
+id: mrnpex50
+name: BLAST template
+description: This is a template for a project using BLAST software.
+icon: fas://syringe
diff --git a/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/scripts/uq2zwimz/form.yml b/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/scripts/uq2zwimz/form.yml
new file mode 100644
index 0000000..e4e95eb
--- /dev/null
+++ b/ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/scripts/uq2zwimz/form.yml
@@ -0,0 +1,51 @@
+---
+title: Simple BLAST job
+created_at: 1707923522
+form:
+- auto_accounts
+- auto_scripts
+- auto_batch_clusters
+attributes:
+  auto_accounts:
+    options:
+    - - PZS1118
+      - PZS1118
+      - {}
+    - - PZS0715
+      - PZS0715
+      - {}
+    - - PZS0714
+      - PZS0714
+      - {}
+    - - PZS1117
+      - PZS1117
+      - data-option-for-cluster-ascend: false
+    - - PAS1604
+      - PAS1604
+      - data-option-for-cluster-ascend: false
+    value: PZS1118
+    label: Account
+    help: ''
+    required: false
+  auto_scripts:
+    options:
+    - - blast.sh
+      - "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/mrnpex50/blast.sh"
+    - - hello_world.sh
+      - "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/mrnpex50/hello_world.sh"
+    directory: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/mrnpex50"
+    value: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/mrnpex50/blast.sh"
+    label: Script
+    help: ''
+    required: false
+  auto_batch_clusters:
+    options:
+    - ascend
+    - owens
+    - pitzer
+    value: owens
+    exclude_options:
+    - ascend
+    label: Cluster
+    help: ''
+    required: false
diff --git a/ondemand.osc.edu/apps/dashboard/projects/BLAST/100.fasta b/ondemand.osc.edu/apps/dashboard/projects/BLAST/100.fasta
new file mode 100644
index 0000000..704835f
--- /dev/null
+++ b/ondemand.osc.edu/apps/dashboard/projects/BLAST/100.fasta
@@ -0,0 +1,5 @@
+>P01013 GENE X PROTEIN (OVALBUMIN-RELATED)
+QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
+KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
+VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP
+FLFLIKHNPTNTIVYFGRYWSP
diff --git a/ondemand.osc.edu/apps/dashboard/projects/BLAST/blast.sh b/ondemand.osc.edu/apps/dashboard/projects/BLAST/blast.sh
new file mode 100644
index 0000000..83d2d76
--- /dev/null
+++ b/ondemand.osc.edu/apps/dashboard/projects/BLAST/blast.sh
@@ -0,0 +1,30 @@
+#!/bin/bash
+#SBATCH -J ondemand/sys/projects/basic_blast
+
+# A Basic BLAST Job
+# https://www.osc.edu/resources/available_software/software_list/blast
+
+#
+# The following lines set up the Blast environment
+#
+module load blast
+module load blast-database
+set -x
+
+#
+# Move to the directory where the job was submitted
+#
+cd $SLURM_SUBMIT_DIR
+mkdir $SLURM_JOBID
+cp 100.fasta $TMPDIR
+cd $TMPDIR
+
+#
+# Run Blast
+#
+/usr/bin/time tblastn -db nt -query 100.fasta -out test.out
+
+#
+# Now, copy data (or move) back once the simulation has completed
+#
+cp test.out $SLURM_SUBMIT_DIR/$SLURM_JOBID